Anti-MFF Antibody FL594 Conjugate, IgG1, Clone: [N382/14], Mouse, Monoclonal

Artikelnummer: ANI-75-366-FL594
Artikelname: Anti-MFF Antibody FL594 Conjugate, IgG1, Clone: [N382/14], Mouse, Monoclonal
Artikelnummer: ANI-75-366-FL594
Hersteller Artikelnummer: 75-366-FL594
Alternativnummer: ANI-75-366-FL594
Hersteller: Antibodies Incorporated
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8), Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical), Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical), Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical)
Konjugation: FL594
Alternative Synonym: Mitochondrial fission factor
Our Anti-MFF mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N382/14. It is KO validated, detects human, mouse, and rat MFF, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Klonalität: Monoclonal
Konzentration: 0.5 mg/mL
Klon-Bezeichnung: [N382/14]
Molekulargewicht: 40 kDa
Isotyp: IgG1
UniProt: Q9GZY8
Puffer: PBS with 0.09% azide
Target-Kategorie: MFF
Antibody Type: Primary Antibody
Anwendungsbeschreibung: Format: Purified by Protein A chromatography