Human GSTP1 protein

Artikelnummer: BYT-ORB604142
Artikelname: Human GSTP1 protein
Artikelnummer: BYT-ORB604142
Hersteller Artikelnummer: orb604142
Alternativnummer: BYT-ORB604142-1,BYT-ORB604142-100,BYT-ORB604142-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: GST class-piGSTP1-1
This Human GSTP1 protein spans the amino acid sequence from region 2-210aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 50.2 kDa
UniProt: P09211
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) GSTP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) GSTP1.