Recombinant Human Kit ligand (KITLG), partial (Active)

Artikelnummer: BYT-ORB2658093
Artikelname: Recombinant Human Kit ligand (KITLG), partial (Active)
Artikelnummer: BYT-ORB2658093
Hersteller Artikelnummer: orb2658093
Alternativnummer: BYT-ORB2658093-1,BYT-ORB2658093-100,BYT-ORB2658093-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Kit ligand, Mast cell growth factor, Stem cell factor, c-Kit ligand, Soluble KIT ligand
This Recombinant Human Kit ligand (KITLG), partial (Active) spans the amino acid sequence from region 26-189aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 19.8 kDa
UniProt: P21583
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 1.813-3.203 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 1.813-3.203 ng/mL.
The purity of KITLG was greater than 95% as determined by SEC-HPLC