Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active)

Artikelnummer: BYT-ORB2658697
Artikelname: Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active)
Artikelnummer: BYT-ORB2658697
Hersteller Artikelnummer: orb2658697
Alternativnummer: BYT-ORB2658697-1,BYT-ORB2658697-100,BYT-ORB2658697-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Activin receptor type-2A, EC:2.7.11.30, Activin receptor type IIA (ACTR-IIA), Acvr2a, Acvr2
This Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active) spans the amino acid sequence from region 20-135aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 14.8 kDa
UniProt: P27038
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2a at 2 µg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 1.562-1.966 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2a at 2 µg/ml can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 1.562-1.966 ng/mL.
The purity of ACVR2A was greater than 95% as determined by SEC-HPLC