Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial (Active)
Artikelnummer:
BYT-ORB2659730
- Bilder (3)
| Artikelname: | Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial (Active) |
| Artikelnummer: | BYT-ORB2659730 |
| Hersteller Artikelnummer: | orb2659730 |
| Alternativnummer: | BYT-ORB2659730-1,BYT-ORB2659730-100,BYT-ORB2659730-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| This Recombinant Human Gastric inhibitory polypeptide receptor(GIPR), partial (Active) spans the amino acid sequence from region 22-138aa. Purity: Greater than 95% as determined by SDS-PAGE. |
| Molekulargewicht: | 16.2 kDa |
| UniProt: | P48546 |
| Puffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2 µg/mL can bind Anti-GIPR recombinant antibody. The EC50 is 16.18-18.70 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Measured by its binding ability in a functional ELISA. Immobilized Human GIPR at 2µg/mL can bind Anti-GIPR recombinant antibody, the EC50 is 16.18-18.70 ng/mL. |
|
|
The purity of GIPR was greater than 95% as determined by SEC-HPLC |
Produktgarantie und fachkundiger Support
