Anti-MATH5/ATOH7 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10096-100
Article Name: Anti-MATH5/ATOH7 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10096-100
Supplier Catalog Number: A10096-100
Alternative Catalog Number: ABC-A10096-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 47-152 of human ATOH7 (NP_660161.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to MATH5/ATOH7.
Clonality: Polyclonal
Concentration: Lot Specific
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: ARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Target: MATH5/ATOH7
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100