Recombinant Macaca fascicularis Cadherin-1 (CDH1), partial (Active)

Catalog Number: BYT-ORB2658097
Article Name: Recombinant Macaca fascicularis Cadherin-1 (CDH1), partial (Active)
Biozol Catalog Number: BYT-ORB2658097
Supplier Catalog Number: orb2658097
Alternative Catalog Number: BYT-ORB2658097-1,BYT-ORB2658097-100,BYT-ORB2658097-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cadherin-1, Epithelial cadherin
This Recombinant Macaca fascicularis Cadherin-1 (CDH1), partial (Active) spans the amino acid sequence from region 155-708aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 61.9 kDa
UniProt: A0A2K5V299
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRENIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPVFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYSILSQDPELPDKNMFTINKNTGVISVVTTGLDRESFPMYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPVFNPTTYKGQVPENQANFVITTLKVTDADAPNTPAW
Application Notes: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CDH1 at 2 µg/mL can bind Anti-CDH1 recombinant antibody. The EC50 is 2.256-2.744 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CDH1 at 2 µg/ml can bind Anti-CDH1 recombinant antibody. The EC50 is 2.256-2.744 ng/mL.
The purity of CDH1 was greater than 95% as determined by SEC-HPLC