Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active)
Catalog Number:
BYT-ORB2658695
- Images (3)
| Article Name: | Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active) |
| Biozol Catalog Number: | BYT-ORB2658695 |
| Supplier Catalog Number: | orb2658695 |
| Alternative Catalog Number: | BYT-ORB2658695-1,BYT-ORB2658695-100 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Activin receptor type-2B,EC: 2.7.11.30, Activin receptor type IIB (ACTR-IIB), Acvr2b |
| This Recombinant Mouse Activin receptor type-2B (Acvr2b), partial spans the amino acid sequence from region 19-137aa. Purity: Greater than 95% as determined by SDS-PAGE. |
| Molecular Weight: | 15.2 kDa |
| UniProt: | P27040 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4 |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTLLT |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2b at 2 µg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody. The EC50 is 3.560-4.235 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |



