Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial

Catalog Number: BYT-ORB2659883
Article Name: Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial
Biozol Catalog Number: BYT-ORB2659883
Supplier Catalog Number: orb2659883
Alternative Catalog Number: BYT-ORB2659883-1,BYT-ORB2659883-100,BYT-ORB2659883-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: vacA, HP_0887, Vacuolating cytotoxin autotransporter [Cleaved into: Vacuolating cytotoxin, Vacuolating cytotoxin translocator]
This Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial spans the amino acid sequence from region 37-245aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 26.6 kDa
UniProt: P55981
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN
Application Notes: Biological Origin: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) vacA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) vacA.