Anti-MBD2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10060-100
Artikelname: Anti-MBD2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10060-100
Hersteller Artikelnummer: A10060-100
Alternativnummer: ABC-A10060-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human MBD2 (NP_003918.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MBD2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 43kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Formulierung: Liquid
Sequenz: IKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Target-Kategorie: MBD2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2000, IHC: 1:50-1:200