Anti-WNT1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A10077-100
| Artikelname: |
Anti-WNT1 Antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ABC-A10077-100 |
| Hersteller Artikelnummer: |
A10077-100 |
| Alternativnummer: |
ABC-A10077-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 231-370 of human WNT1 (NP_005421.1). |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to WNT1. |
| Klonalität: |
Polyclonal |
| Konzentration: |
Lot Specific |
| Molekulargewicht: |
49kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol. |
| Formulierung: |
Liquid |
| Sequenz: |
TCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL |
| Target-Kategorie: |
WNT1 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:1000-1:4000 |
