Anti-PTPRE Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10085-100
Artikelname: Anti-PTPRE Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10085-100
Hersteller Artikelnummer: A10085-100
Alternativnummer: ABC-A10085-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human PTPRE (NP_006495.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PTPRE.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 81 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: LRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFRFRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKE
Target-Kategorie: PTPRE
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200