Anti-ETS2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10117-100
Artikelname: Anti-ETS2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10117-100
Hersteller Artikelnummer: A10117-100
Alternativnummer: ABC-A10117-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-469 of human ETS2 (P15036).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ETS2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 53 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVS
Target-Kategorie: ETS2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200