Anti-PDCD2L Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10135-100
Artikelname: Anti-PDCD2L Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10135-100
Hersteller Artikelnummer: A10135-100
Alternativnummer: ABC-A10135-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-358 of human PDCD2L (NP_115722.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PDCD2L.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMK
Target-Kategorie: PDCD2L
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200