Anti-ATG9B Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10143-100
Artikelname: Anti-ATG9B Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10143-100
Hersteller Artikelnummer: A10143-100
Alternativnummer: ABC-A10143-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 715-924 of human ATG9B (NP_775952.4).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ATG9B.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 100 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: HPLWRPPGHSSKFLGHLWGRVQQDAAAWGATSARGPSTPGVLSNCTSPLPEAFLANLFVHPLLPPRDLSPTAPCPAAATASLLASISRIAQDPSSVSPGGTGGQKLAQLPELASAEMSLHVIYLHQLHQQQQQQEPWGEAAASILSRPCSSPSQPPSPDEEKPSWSSDGSSPASSPRQQWGTQKARNLFPGGFQVTTDTQKEPDRASCTD
Target-Kategorie: ATG9B
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200