Anti-FGF6 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10189-100
Artikelname: Anti-FGF6 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10189-100
Hersteller Artikelnummer: A10189-100
Alternativnummer: ABC-A10189-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF6 (NP_066276.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FGF6.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 22 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQV
Target-Kategorie: FGF6
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000