Anti-GYPB/GPB Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10194-100
Artikelname: Anti-GYPB/GPB Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10194-100
Hersteller Artikelnummer: A10194-100
Alternativnummer: ABC-A10194-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-91 of human GYPB (NP_002091.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GYPB/GPB.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 25 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYTIRRLIKA
Target-Kategorie: GYPB/GPB
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000