Anti-Fetal Hemoglobin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A10195-100
| Artikelname: |
Anti-Fetal Hemoglobin Antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ABC-A10195-100 |
| Hersteller Artikelnummer: |
A10195-100 |
| Alternativnummer: |
ABC-A10195-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HBG2 (NP_000175.1). |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to Fetal Hemoglobin. |
| Klonalität: |
Polyclonal |
| Konzentration: |
Lot Specific |
| Molekulargewicht: |
13 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Formulierung: |
Liquid |
| Sequenz: |
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVD |
| Target-Kategorie: |
Fetal Hemoglobin |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:100-1:500 |
