Anti-Phospholipase C gamma 1/PLC-gamma-1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10208-100
Artikelname: Anti-Phospholipase C gamma 1/PLC-gamma-1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10208-100
Hersteller Artikelnummer: A10208-100
Alternativnummer: ABC-A10208-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PLC gamma 1 (PLCG1) (NP_002651.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Phospholipase C gamma 1/PLC-gamma-1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 160 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: NSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALF
Target-Kategorie: Phospholipase C gamma 1/PLC-gamma-1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000