Anti-PRKACG Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10210-100
Artikelname: Anti-PRKACG Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10210-100
Hersteller Artikelnummer: A10210-100
Alternativnummer: ABC-A10210-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-351 of human PRKACG (NP_002723.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PRKACG.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 40 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: KIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Target-Kategorie: PRKACG
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500