Anti-FLVCR2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10228-100
Artikelname: Anti-FLVCR2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10228-100
Hersteller Artikelnummer: A10228-100
Alternativnummer: ABC-A10228-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLVCR2 (NP_060261.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FLVCR2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 57 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSSGPEDLSVIKVSRRRWAVVLVFSCYSMCNSF
Target-Kategorie: FLVCR2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000