Anti-LH1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10250-100
Artikelname: Anti-LH1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10250-100
Hersteller Artikelnummer: A10250-100
Alternativnummer: ABC-A10250-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-295 of human PLOD1 (NP_000293.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to LH1.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 84 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: KGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGLGEDWNVEKGTSAGGGQKVRLLKKALEKHADKEDLVILFADSYDVLFASGPRELLKKFRQARSQVVFSAEELIYPDRRLETKYPVVSDGKRFLGSGGFIGYAPNLSKLVAEWEGQDSDSDQLFYTKIFLDPEKREQINITLDHRCRIFQNLDGALDEVVLKFEMGHVRARNLAYDTLPVLIHGNGPTKLQLNYLGNYIPRFWTFETGCTVCDEG
Target-Kategorie: LH1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000