Anti-MRP6/ARA Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10295-100
Artikelname: Anti-MRP6/ARA Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10295-100
Hersteller Artikelnummer: A10295-100
Alternativnummer: ABC-A10295-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 830-940 of human ABCC6 (NP_001162.4).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MRP6/ARA.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 164 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: AIAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRVKATVHLAYLR
Target-Kategorie: MRP6/ARA
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000