Anti-ATP5O Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10296-100
Artikelname: Anti-ATP5O Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10296-100
Hersteller Artikelnummer: A10296-100
Alternativnummer: ABC-A10296-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-213 of human ATP5O (NP_001688.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ATP5O.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 23 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Target-Kategorie: ATP5O
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200