Anti-TROP2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10307-100
Artikelname: Anti-TROP2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10307-100
Hersteller Artikelnummer: A10307-100
Alternativnummer: ABC-A10307-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 27-270 of human TROP-2 (NP_002344.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TROP2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 37 - 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSM
Target-Kategorie: TROP2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200