Anti-Uroplakin Ib/UPIb Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10319-100
Artikelname: Anti-Uroplakin Ib/UPIb Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10319-100
Hersteller Artikelnummer: A10319-100
Alternativnummer: ABC-A10319-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-230 of human UPK1B (NP_008883.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Uroplakin Ib/UPIb.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: ATQQDFFTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNRHA
Target-Kategorie: Uroplakin Ib/UPIb
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000