Anti-ATG2A Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10459-100
Artikelname: Anti-ATG2A Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10459-100
Hersteller Artikelnummer: A10459-100
Alternativnummer: ABC-A10459-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-800 of human ATG2A (NP_055919.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ATG2A.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 213 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: DLHGIYEDGGKPPVPCLRVSKALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSKRTMYETEEMVIPGDPEEMRT
Target-Kategorie: ATG2A
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000