Anti-PDGFRL Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A10633-100
Artikelname: Anti-PDGFRL Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A10633-100
Hersteller Artikelnummer: A10633-100
Alternativnummer: ABC-A10633-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 15-205 of human PDGFRL (NP_006198.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PDGFRL.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 42 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: ALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGEFSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKV
Target-Kategorie: PDGFRL
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:2,000