Anti-CBS Antibody [ARC0643], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A80837-100
Artikelname: Anti-CBS Antibody [ARC0643], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A80837-100
Hersteller Artikelnummer: A80837-100
Alternativnummer: ABC-A80837-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-551 of human CBS (P35520).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0643] antibody to CBS.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0643]
Molekulargewicht: 61 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Target-Kategorie: CBS
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200