Anti-AMID Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A80936-100
Artikelname: Anti-AMID Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A80936-100
Hersteller Artikelnummer: A80936-100
Alternativnummer: ABC-A80936-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 43-371 of human AIFM2/AMID/AMID (NP_116186.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to AMID.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 41 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: KDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYL
Target-Kategorie: AMID
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000