Anti-Cdk9 Antibody [ARC0527], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81021-100
Artikelname: Anti-Cdk9 Antibody [ARC0527], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81021-100
Hersteller Artikelnummer: A81021-100
Alternativnummer: ABC-A81021-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 273-372 of human CDK9 (P50750).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0527] antibody to Cdk9.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0527]
Molekulargewicht: 42 kDa / 55 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: RKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
Target-Kategorie: Cdk9
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000, ChIP: 1:50-1:200, ChIP-seq: 2-4µg/IP, CUT&Tag: 16 cells/5µg