Anti-Mad2L1 Antibody [ARC0603], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A81048-100
Artikelname: Anti-Mad2L1 Antibody [ARC0603], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A81048-100
Hersteller Artikelnummer: A81048-100
Alternativnummer: ABC-A81048-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2/MAD2L1 (Q13257).
Konjugation: Unconjugated
Rabbit monoclonal [ARC0603] antibody to Mad2L1.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC0603]
Molekulargewicht: 24 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: EQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS
Target-Kategorie: Mad2L1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200