Anti-Hexokinase II Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8368-100
Artikelname: Anti-Hexokinase II Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8368-100
Hersteller Artikelnummer: A8368-100
Alternativnummer: ABC-A8368-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A recombinant protein corresponding to amino acids 1-120 of human Hexokinase II.
Konjugation: Unconjugated
Rabbit polyclonal antibody to Hexokinase II.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 115 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% ProClin 300.
Formulierung: Liquid
Sequenz: MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
Target-Kategorie: Hexokinase II
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000