Anti-QKI Antibody [ARC2500], Unconjugated, Rabbit, Monoclonal

Artikelnummer: ABC-A8374-100
Artikelname: Anti-QKI Antibody [ARC2500], Unconjugated, Rabbit, Monoclonal
Artikelnummer: ABC-A8374-100
Hersteller Artikelnummer: A8374-100
Alternativnummer: ABC-A8374-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 242-341 of human QKI (Q96PU8).
Konjugation: Unconjugated
Rabbit monoclonal [ARC2500] antibody to QKI.
Klonalität: Monoclonal
Konzentration: Lot Specific
Klon-Bezeichnung: [ARC2500]
Molekulargewicht: 38 kDa / 40 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: RTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
Target-Kategorie: QKI
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:500-1:1,000, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000