Anti-COLEC12 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8613-100
Artikelname: Anti-COLEC12 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8613-100
Hersteller Artikelnummer: A8613-100
Alternativnummer: ABC-A8613-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-270 of human COLEC12 (NP_569057.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to COLEC12.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 110 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: KVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAA
Target-Kategorie: COLEC12
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000