Anti-Jagged 2/JAG2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88503-100
Artikelname: Anti-Jagged 2/JAG2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88503-100
Hersteller Artikelnummer: A88503-100
Alternativnummer: ABC-A88503-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-200 of human JAG2 (NP_002217.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Jagged 2/JAG2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 150 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: ARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDE
Target-Kategorie: Jagged 2/JAG2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200