Anti-Histone H3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88523-100
Artikelname: Anti-Histone H3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88523-100
Hersteller Artikelnummer: A88523-100
Alternativnummer: ABC-A88523-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human HIST3H3 (NP_003484.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Histone H3.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 17 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Target-Kategorie: Histone H3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:2,000-1:10,000, IHC: 1:50-1:200, IP: 1:50-1:200, ChIP: 1:50-1:200