Anti-POLR2H Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88536-100
Artikelname: Anti-POLR2H Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88536-100
Hersteller Artikelnummer: A88536-100
Alternativnummer: ABC-A88536-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human POLR2H (NP_006223.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to POLR2H.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 17 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Target-Kategorie: POLR2H
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IP: 1:50-1:200