Anti-NME2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88545-100
Artikelname: Anti-NME2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88545-100
Hersteller Artikelnummer: A88545-100
Alternativnummer: ABC-A88545-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-267 of human NME1-NME2 (NP_001018146.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NME2.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 17 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRTMANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELV
Target-Kategorie: NME2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000