Anti-Natriuretic peptides A Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88550-100
Artikelname: Anti-Natriuretic peptides A Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88550-100
Hersteller Artikelnummer: A88550-100
Alternativnummer: ABC-A88550-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human NPPA (NP_006154.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Natriuretic peptides A.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 16 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN
Target-Kategorie: Natriuretic peptides A
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200