Anti-GDX Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88589-100
Artikelname: Anti-GDX Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88589-100
Hersteller Artikelnummer: A88589-100
Alternativnummer: ABC-A88589-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human UBL4A (NP_055050.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GDX.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 14 - 16 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
Target-Kategorie: GDX
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:1,000, IP: 1:500-1:1,000