Anti-CDKN2C Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88611-100
Artikelname: Anti-CDKN2C Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88611-100
Hersteller Artikelnummer: A88611-100
Alternativnummer: ABC-A88611-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A recombinant fusion protein corresponding to amino acids 1-168 of human CDKN2C.
Konjugation: Unconjugated
Rabbit polyclonal antibody to CDKN2C.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 18 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Target-Kategorie: CDKN2C
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000