Anti-NRN1L Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A88613-100
Artikelname: Anti-NRN1L Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A88613-100
Hersteller Artikelnummer: A88613-100
Alternativnummer: ABC-A88613-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 39-139 of human NRN1L (Q496H8).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NRN1L.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 18 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: PNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA
Target-Kategorie: NRN1L
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000