Anti-DC-SIGNR Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89986-100
Artikelname: Anti-DC-SIGNR Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89986-100
Hersteller Artikelnummer: A89986-100
Alternativnummer: ABC-A89986-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLEC4M (NP_055072.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to DC-SIGNR.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV
Target-Kategorie: DC-SIGNR
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200