Anti-PDK4 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90016-100
Artikelname: Anti-PDK4 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90016-100
Hersteller Artikelnummer: A90016-100
Alternativnummer: ABC-A90016-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 312-411 of human PDK4 (NP_002603.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PDK4.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 46 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: STAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
Target-Kategorie: PDK4
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200