Anti-Neuroserpin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90039-100
Artikelname: Anti-Neuroserpin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90039-100
Hersteller Artikelnummer: A90039-100
Alternativnummer: ABC-A90039-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 181-410 of human SERPINI1 (NP_005016.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Neuroserpin.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 46 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: INAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Target-Kategorie: Neuroserpin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:100, ICC/IF: 1:50-1:100