Anti-Orexin Receptor 1/Ox-1-R Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90051-100
Artikelname: Anti-Orexin Receptor 1/Ox-1-R Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90051-100
Hersteller Artikelnummer: A90051-100
Alternativnummer: ABC-A90051-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HCRTR1 (NP_001516.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Orexin Receptor 1/Ox-1-R.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 48 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: HPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGT
Target-Kategorie: Orexin Receptor 1/Ox-1-R
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200