Anti-SNX5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90076-100
Artikelname: Anti-SNX5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90076-100
Hersteller Artikelnummer: A90076-100
Alternativnummer: ABC-A90076-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 145-404 of human SNX5 (NP_055241.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SNX5.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 47 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: VFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCID
Target-Kategorie: SNX5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000