Anti-TDO2/TDO Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90128-100
Artikelname: Anti-TDO2/TDO Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90128-100
Hersteller Artikelnummer: A90128-100
Alternativnummer: ABC-A90128-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TDO2 (NP_005642.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TDO2/TDO.
Klonalität: Polyclonal
Konzentration: Lot Specific
Molekulargewicht: 48 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: GHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKT
Target-Kategorie: TDO2/TDO
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:100-1:500