ALB monoclonal antibody (M01), clone 1G12-1B3, Clone: [1G12-1B3], Mouse, Monoclonal

Artikelnummer: ABN-H00000213-M01
Artikelname: ALB monoclonal antibody (M01), clone 1G12-1B3, Clone: [1G12-1B3], Mouse, Monoclonal
Artikelnummer: ABN-H00000213-M01
Hersteller Artikelnummer: H00000213-M01
Alternativnummer: ABN-H00000213-M01-100
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: ALB (AAH34023, 19 a.a. ~ 609 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full length recombinant ALB.
Klonalität: Monoclonal
Klon-Bezeichnung: [1G12-1B3]
UniProt: 213
Puffer: In 1x PBS, pH 7.4
Sequenz: RGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGD
Target-Kategorie: ALB